What is the Unicode codepoint for Fish cake with swirl?

The 🍥 Fish cake with swirl emoji is encoded as U+1F365 (hex 1F365). It belongs to the Food Asian group inside Food & Drink.

How do I copy the 🍥 emoji?

Open this page and click "Copy emoji". The 🍥 character is copied to your clipboard so you can paste it into any app that supports Unicode emojis.

Does Fish cake with swirl have shortcodes?

Yes. Common shortcodes include :fish_cake:, :cake:, :fish:, and :fish_cake_with_swirl:. Platforms like Slack, Discord, and GitHub render these as the 🍥 emoji automatically.

Fluent 3D

Native Unicode

Fish cake with swirl

Fish cake with swirl — Food & Drink emoji.

Name

fish cake with swirl

Shortcodes

:fish_cake::cake::fish::fish_cake_with_swirl::pastry::swirl:

Themes

fooddessertcelebrationanimalmarinecakefishpastryswirl

Download as image

Renders 🍥 with your system emoji font into PNG, WebP, or SVG. Pick a pixel size, then download.

Note: PNG and WebP use the emoji font installed on your device (Apple Color Emoji on macOS/iOS, Segoe UI Emoji on Windows, Noto Color Emoji on Android/Linux), so the look matches your platform. SVG embeds the character as text — rendering depends on the viewer.

Microsoft Fluent UI Emoji — pixel-perfect originals

Download Microsoft's official Fluent rendering of 🍥. SVG files are vector (scales to any size); the 3D PNG is 1024×1024.

About the 🍥 Fish cake with swirl emoji

The 🍥 Fish cake with swirl emoji is part of the Food & Drink category and the food asian group on DBEmoji. Shortcodes such as :fish_cake:, :cake:, and :fish: resolve to this emoji on platforms like Slack, Discord, and GitHub.

Fish cake with swirl (Unicode codepoint U+1F365) fish cake with swirl — Food & Drink emoji.. Meet 🍥 — the fish cake with swirl emoji, filed under Food & Drink › Food Asian. Food emojis are punchy in marketing copy — 🍥 can stand in for an entire menu item in one glyph. Its Unicode codepoint sequence is U+1F365 (1F365). It joined the Unicode standard in version 6.0 and shipped on iOS from version 6.0 onward. Common shortcodes: :fish_cake:, :cake:, :fish:, :fish_cake_with_swirl:. Visually, the dominant palette leans blue based on Twemoji pixel analysis. It shows up under food, dessert, celebration, animal, and marine tag views. One tap on 🍥 is all it takes — the glyph copies straight to your clipboard.

When to use 🍥 Fish cake with swirl

Plating up restaurant photos, recipes, and grocery hauls
Captioning meal plans, food deliveries, and lunch updates
Pairing with drink emojis for cafe and dinner content
Throwing confetti on birthdays, milestones, and launches

Combinations and pairings

Pair 🍥 with food-themed, dessert-themed, and celebration-themed emojis to reinforce the same vibe in one message.
Lead a caption with 🍥 for a quick visual hook, or close a sentence with it as a reaction.

How to copy the 🍥 Fish cake with swirl emoji

Open the emoji page. Visit the Fish cake with swirl emoji page on DBEmoji to see the character, codepoint, and meaning side by side.
Tap Copy emoji. Click the "Copy emoji" button. The 🍥 character is placed on your clipboard instantly — no signup, no download.
Paste anywhere. Paste into any chat app, social network, document, or text field that supports Unicode. The emoji renders using the platform's native style.

Frequently asked questions

What does the 🍥 Fish cake with swirl emoji mean?: Meet 🍥 — the fish cake with swirl emoji, filed under Food & Drink › Food Asian. Food emojis are punchy in marketing copy — 🍥 can stand in for an entire menu item in one glyph. Its Unicode codepoint sequence is U+1F365 (1F365). It joined the Unicode standard in version 6.0 and shipped on iOS from version 6.0 onward. Common shortcodes: :fish_cake:, :cake:, :fish:, :fish_cake_with_swirl:. Visually, the dominant palette leans blue based on Twemoji pixel analysis. It shows up under food, dessert, celebration, animal, and marine tag views. One tap on 🍥 is all it takes — the glyph copies straight to your clipboard.
What is the Unicode codepoint for Fish cake with swirl?: The 🍥 Fish cake with swirl emoji is encoded as U+1F365 (hex 1F365). It belongs to the Food Asian group inside Food & Drink.
How do I copy the 🍥 emoji?: Open this page and click "Copy emoji". The 🍥 character is copied to your clipboard so you can paste it into any app that supports Unicode emojis.
Does Fish cake with swirl have shortcodes?: Yes. Common shortcodes include :fish_cake:, :cake:, :fish:, and :fish_cake_with_swirl:. Platforms like Slack, Discord, and GitHub render these as the 🍥 emoji automatically.